SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 390236.BAPKO_5004 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  390236.BAPKO_5004
Domain Number 1 Region: 13-108
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 3.14e-26
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 390236.BAPKO_5004
Sequence length 115
Comment (Borrelia afzelii PKo)
Sequence
MNKKIYSIEELVDKISMPVVAYSGEAKSFLREALEYAKNKDYEKAALTIQESKNSIAKAH
EAHREIIQQSATNPNSVKTPFILIHAEDHLMSAISELSIFEELINVYKIINEIKK
Download sequence
Identical sequences Q0SL50
gi|111074123|ref|YP_709251.1| 390236.BAPKO_5004 WP_011600700.1.101990 WP_011600700.1.4002 WP_011600700.1.40725 WP_011600700.1.72423 WP_011600700.1.79404 WP_011600700.1.94617 gi|111074123|ref|YP_709251.1| gi|111074123|ref|YP_709251.1|NC_008274 gi|216997238|ref|YP_002333783.1|NC_011650 gi|384206197|ref|YP_005591972.1|NC_017229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]