SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 391037.Sare_2202 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  391037.Sare_2202
Domain Number 1 Region: 72-586
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 1.57e-200
Family Heme-dependent catalases 0.0000000000663
Further Details:      
 
Domain Number 2 Region: 594-742
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 0.000000000916
Family Catalase, C-terminal domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 391037.Sare_2202
Sequence length 748
Comment (Salinispora arenicola CNS-205)
Sequence
MDPNKPAKAVEGVVQAAAEEGADVTRADVPGAPGSAPPSVEEPTEPHDPLPSRKEQGTPE
TRTPTGATTGLPPAANGQQGAFLTTAQGARLRDTDHSLKAGPRGPILMQDHHFREKITHF
DHERIPERVVHARGAGAHGVFTSYGAAEVTRAGFLRKGKETPVFVRFSTVLGSRGSADTV
RDTRGFATKFYTDEGNFDLVGNNMPVFFIQDAIKFPDIIHAGKPHPDREIPQAQSAHDTF
WDFVSLHTEAQHHAMWNMSDRGIPRSFRMMEGFGVHTFRLVNAAGETALAKFHWKPKLGV
HSLTWEEAQMISGMDPDFHRRDLYDAIEAGAYPEWELGLQIVPDSPEETFAGVDLLDPTK
FVPEELAPVQPVGMLVLNRMPTNFFAETEQVAFHVGSLVAGIDVTNDPLLQGRLFSYVDT
QLTRLAGPNFPQIPINRPHAPVNDLLRDGFHQQAVHTGVAPYRPNSLDGGNPFPAGDDEN
AFLDVPVTVAEAPKVRANPVSFDDHFSQVRLFWLSMSPVEREHIIRAYTFELSKCYHQEI
KERQLRCLANIDPVLCAQVAAGLGLPAPEPTVPPVDVEPSPALSQLGRTWPTDGRTVGIV
VDADSDLDGVDGVRSAVFAAGMVPLLVAAHGGKVGELPVQRTFATGRATEFDALLLAGAP
APAPDALPAADAGHATLVDPRVRLLVQESWRHAKAIGGWGAGVSVLEQAGVLGTPGVVTG
GSGTDVLAGVQRLMAAHRVWERFPTAVT
Download sequence
Identical sequences A8M0Q3
WP_012182365.1.69805 391037.Sare_2202 gi|159037801|ref|YP_001537054.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]