SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 391037.Sare_2760 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  391037.Sare_2760
Domain Number 1 Region: 311-444
Classification Level Classification E-value
Superfamily Oxidoreductase molybdopterin-binding domain 1.57e-26
Family Oxidoreductase molybdopterin-binding domain 0.0014
Further Details:      
 
Weak hits

Sequence:  391037.Sare_2760
Domain Number - Region: 99-202
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.0123
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 391037.Sare_2760
Sequence length 447
Comment (Salinispora arenicola CNS-205)
Sequence
MPGRHDDGSTDEREYGFPVPMWRALARHPPPGTGAARRGWRSPLRGPWLTSVYGGILLAT
LPLVILTGLLDYLAYGPQFNQAFPRDVGWLRLPQVDWPTRPSWLFRVTQGLHVTLGIMLV
PVVLAKLWSVIPKLFVWPPARSVAQVLERLSLLLLVGGILFEIATGLLNIQYAYLFGFDF
YTAHYFGAWVFTGALVAHVALKLPRMVSALRAGPPADETPSGPTATRPEPPDPDGLVAPQ
PAAGTVSRRGAVTLVGGGALLLGALTVGQTLDGPLRRTALLLPRGQDPGDGPNGFPVNRT
AAAAGISAEDTGPDWRLTLRNGGREITVDRPGLLAMTQHSARLPIACVEGWSTQQYWTGV
RLRDLAGLVGAVDPVTAQVRSLERSGLFNQVTLQANQVFDADSLLALRVNGAELSADHGY
PARIIVPALPGVHCTKWVATIEFRTDG
Download sequence
Identical sequences A8M5M7
391037.Sare_2760 WP_012182896.1.69805 WP_012182896.1.91622 gi|159038333|ref|YP_001537586.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]