SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 391038.Bphy_0433 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  391038.Bphy_0433
Domain Number 1 Region: 95-360
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.21e-77
Family D-glucarate dehydratase-like 0.0000597
Further Details:      
 
Domain Number 2 Region: 1-112
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.84e-34
Family Enolase N-terminal domain-like 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 391038.Bphy_0433
Sequence length 382
Comment (Burkholderia phymatum STM815)
Sequence
MKITKIETFIVPPRWCFVKIETDEGIVGWGEPVVEGRAHTVAAAVDELSDYLLGKDPRNI
EDHWQVMYRAGFYRGGPISMSAIAGVDQALWDIKGKFHGVPVHTLLGGQVRDRIKVYSWI
GGDRPGDVANNARAVVERGFKAVKMNGSEELQIIDTFDKVQGVINNVSAVREAVGPNVGI
GVDFHGRVHKPMAKVLAKELDPYKLMFIEEPVLSENAEALRDIVNQTSTPIALGERLYSR
WDFKHILAGGYVDIIQPDASHAGGITECRKIASMAEAYDVALALHCPLGPIALATCLQID
AVSYNAFIQEQSLGIHYNQGNDLLDYIKNPEVFKYEDGFVSIPQGPGLGIEVNEEKVREM
AKVGHRWRNPVWRHADGSVAEW
Download sequence
Identical sequences B2JDA9
gi|186475202|ref|YP_001856672.1| 391038.Bphy_0433 WP_012399852.1.55900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]