SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 391165.GbCGDNIH1_1181 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  391165.GbCGDNIH1_1181
Domain Number 1 Region: 139-421
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.5e-122
Family Enolase 0.000000039
Further Details:      
 
Domain Number 2 Region: 4-138
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.85e-55
Family Enolase N-terminal domain-like 0.00000404
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 391165.GbCGDNIH1_1181
Sequence length 425
Comment (Granulobacter bethesdensis CGDNIH1)
Sequence
MAAIADIIAREILDSRGNPTVEVDVTLESGAQGRAAVPSGASTGAHEAVELRDGDKSRYG
GKGVLHAVSFVEGEIFEAIGGMDASEQLRIDETLIAVDGTPNKSRLGANAMLAVSLATAK
AAANHQGVPLYRYLGGVYARTLPVPMMNIVNGGKHADNPIDIQEFMIQPVAAPTIADAVR
VGAEIFAALKKELSAAGHNTNVGDEGGFAPGLKSAEEALSFITKACEKAGYRPGEDVTFA
LDCAATEFFKDGVYDLEGEGKKFDAAGMVRYLEDLAAKFPIVSIEDGLAEDDWEGWKLLT
DTLGRKVQLVGDDLFVTNPDRLRHGIALGTANAILVKVNQIGTLSETLEAVETAHRAGYA
AVMSHRSGETEDSTIADLAVATNCGQIKTGSLSRSDRTAKYNQLIRIEQDLDTSGRYAGR
TILRG
Download sequence
Identical sequences Q0BSX3 W6I4B6
391165.GbCGDNIH1_1181 gi|114327845|ref|YP_745002.1| WP_011631888.1.12764 WP_011631888.1.23923 WP_011631888.1.39002 WP_011631888.1.44446 WP_011631888.1.65638 WP_011631888.1.72603 WP_011631888.1.90404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]