SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 392499.Swit_1880 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  392499.Swit_1880
Domain Number 1 Region: 399-623
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.11e-37
Family PFOR PP module 0.049
Further Details:      
 
Domain Number 2 Region: 18-202
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.03e-28
Family Pyruvate oxidase and decarboxylase Pyr module 0.032
Further Details:      
 
Weak hits

Sequence:  392499.Swit_1880
Domain Number - Region: 603-658
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.000419
Family Single 4Fe-4S cluster ferredoxin 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 392499.Swit_1880
Sequence length 708
Comment (Sphingomonas wittichii RW1)
Sequence
MAERSFAAEVELLKLGEGETFTGEGILAVTKALLQSGVAYVGGYQGSPISHLMDVFADAN
DLLASLGVHFEASASEATAAAMLAASVNYPLRGAVAWKSVVGTNVASDALSNVASGGVTG
GALVIVGEDYGEGSSIMQERTHAFAMKSQMWLIDPRPNLPSIVDAVEQGFRLSEASNTPV
MLELRVRSCHMTGSFVAKDNLRPAMTVDEAAAAPVRDTSRIVLPPANFLHEVEKVEKRWP
AGIAFVRENRLNEWFGPDEGEVGLIVQGGLFNSLNRAMELLGLSDAFGAARLPVYCLNVT
YPLIPDEVAAFCRGKRAVLVLEEGQPEFIEHELNTLVRRADLQTRIVGKEVLPRAGDYTA
HVMAQGLRTFLAEWQPALDLPDLSIAPLPAPVAAQIPQRPAGFCTGCPERPVFTSMKLLE
RELGPTHVSADIGCHLFSILPPFNIGNTTMGYGLGTAGASAFKPKDKRAIAVMGDGGFWH
NGLTSGIGNAVFNKDDTVTVIVDNGYSAATGGQDILSSRADNRARTTRHPIERAVRGIGA
GWVRTVDRTYDLKRMMAALREAMTSPERGPKIVVAQSECMLNRQRREKPRVRKAMSEGKR
VVRERFGVDPDTCTGDHSCIRLSGCPSLSIKPNPDPLRRDPVAHVDNSCVGCGLCGEVSH
AAVLCPSFYRASIVANPGRWEGRWKALRSRLIGALQKRDARLRAARAF
Download sequence
Identical sequences A5V7H4
gi|148554796|ref|YP_001262378.1| WP_011952718.1.69875 392499.Swit_1880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]