SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 393115.FTF1231 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  393115.FTF1231
Domain Number 1 Region: 16-227
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.21e-55
Family PP-loop ATPase 0.0000576
Further Details:      
 
Domain Number 2 Region: 308-397
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.0000000000000837
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.0097
Further Details:      
 
Domain Number 3 Region: 205-306
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.0000000497
Family MesJ substrate recognition domain-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 393115.FTF1231
Sequence length 398
Comment (Francisella tularensis FSC 198)
Sequence
MSISKSLVLNEIKKFSPSHIIIGYSGGVDSSVLLNISKELDIPLIAIYINHNLHRDSLKW
QIHCQQTCQKYNLQFISHSLDKVPKGESFEAWASKQRMAFFQKIMQQYSKPLLLLGHHQD
DQAETFLIQAIRGSGLAGLAGIPHYKELHHGGVLRPLLKYSKIEIEGFAKLNNISYIYDD
SNEDIKYRRNLIRNQIIPILQQVNPNISQTLSRSANICAESNNILQKLLTERLQSISQDT
NLIISELIKLDDDIQKNLLHLWFKQNTQQSLKSKQIKELHLAVNNPSTGWQIDISNYYQI
HIQYNQLIIKYPTTINDISKEDIISWLSKNLNEEIDLTKIVIRDRKPDDKCKYRGRNKPN
KLKILFQELQIPTTERSKAKIILKDQQIIAVYPFFICG
Download sequence
Identical sequences A0A0E2ZH43 A0A0H3TMQ7 A4IXE6 Q14H05 Q5NFK3
gi|56708293|ref|YP_170189.1| 177416.FTT_1231 393115.FTF1231 418136.FTW_0715 gi|379717529|ref|YP_005305865.1| WP_003018488.1.101979 WP_003018488.1.11695 WP_003018488.1.17073 WP_003018488.1.17471 WP_003018488.1.1833 WP_003018488.1.19035 WP_003018488.1.2301 WP_003018488.1.25812 WP_003018488.1.26192 WP_003018488.1.26690 WP_003018488.1.31410 WP_003018488.1.35965 WP_003018488.1.36081 WP_003018488.1.37819 WP_003018488.1.3831 WP_003018488.1.38474 WP_003018488.1.38662 WP_003018488.1.39861 WP_003018488.1.40634 WP_003018488.1.42944 WP_003018488.1.44744 WP_003018488.1.45210 WP_003018488.1.4633 WP_003018488.1.47286 WP_003018488.1.50994 WP_003018488.1.52816 WP_003018488.1.53326 WP_003018488.1.5414 WP_003018488.1.5563 WP_003018488.1.56738 WP_003018488.1.5829 WP_003018488.1.59625 WP_003018488.1.60146 WP_003018488.1.61154 WP_003018488.1.65967 WP_003018488.1.66077 WP_003018488.1.66092 WP_003018488.1.66463 WP_003018488.1.67317 WP_003018488.1.75261 WP_003018488.1.77053 WP_003018488.1.78037 WP_003018488.1.80474 WP_003018488.1.80616 WP_003018488.1.82545 WP_003018488.1.87851 WP_003018488.1.98147 YP_170189.1.84429 gi|379726133|ref|YP_005318319.1| IDP02714 gi|134301750|ref|YP_001121718.1| gi|110670764|ref|YP_667321.1| gi|385794988|ref|YP_005831394.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]