SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 393595.ABO_2526 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  393595.ABO_2526
Domain Number 1 Region: 2-45
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000126
Family Sfri0576-like 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 393595.ABO_2526
Sequence length 46
Comment (Alcanivorax borkumensis SK2)
Sequence
MLQDALVGLRHPLSWHRIAVVTSHDWISNVAQQASALIPGEVKAFK
Download sequence
Identical sequences Q0VLH4
393595.ABO_2526 gi|110835387|ref|YP_694246.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]