SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 394.NGR_c35160 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  394.NGR_c35160
Domain Number 1 Region: 4-189
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 9.68e-51
Family Methylesterase CheB, C-terminal domain 0.0000549
Further Details:      
 
Weak hits

Sequence:  394.NGR_c35160
Domain Number - Region: 226-259
Classification Level Classification E-value
Superfamily YfgJ-like 0.068
Family YfgJ-like 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 394.NGR_c35160
Sequence length 338
Comment (Rhizobium NGR234)
Sequence
MGHRDVIAIGGSMGAVGAMKHLLRGLPPDFPAVLFVVIHVGVRGNDLLADVLGHGAHLPV
TTAIDGERVQRGHVYVAPADHHLLVIDDVIHLGRGPRENLSRPAIDPLFRSVGAHYGPRA
IAVVLTGMLNDGAAGLADAKQCGSVTVVQNPSDAVASDMPIGALKASEVDYRAPLADLPA
LLCQLTREEAGLPVAIPPDITLEIDIALGRKIDSATLAEIADAVPLSCPACGGVLSQIKA
RPPLRFRCQVGHAYTSETLVADSEGAVDEAMRVALRIIEERVTLSEKMADDARRNGLGAA
AAANGRRAEEGRQHAETLRRAILGKSENAAAEKVEDAE
Download sequence
Identical sequences C3MC15
394.NGR_c35160 gi|227824020|ref|YP_002827993.1| YP_002827993.1.63916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]