SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 394503.Ccel_0093 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  394503.Ccel_0093
Domain Number 1 Region: 5-137
Classification Level Classification E-value
Superfamily FlgN-like 3.4e-17
Family FlgN-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 394503.Ccel_0093
Sequence length 166
Comment (Clostridium cellulolyticum H10)
Sequence
MDTGLIKELTDILNKENDIYETFLKLSNSKTDLITNGNVSELESIVKIEQSLIIKIAKLE
DQREKIVESLSSVLGRKPEEVTISELSSCLGEKEAMELKACQEKILKSINGLKSNNELNS
KLIKNSLEYIDFSINMMTTVGTVTNSYGSSGNADEGKKRNLFDVKL
Download sequence
Identical sequences B8I4C7
gi|220927552|ref|YP_002504461.1| WP_012634547.1.84728 394503.Ccel_0093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]