SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 394503.Ccel_0885 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  394503.Ccel_0885
Domain Number 1 Region: 8-279
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.39e-71
Family Phosphate binding protein-like 0.0000683
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 394503.Ccel_0885
Sequence length 284
Comment (Clostridium cellulolyticum H10)
Sequence
MGKGRIIKALAAAMALTFLVAGCGASGDSSKSSGTAASSNIAVDESWDKVKEKGELVMGL
DENFPPMGFRDEDNNIVGYDLDLAKEVASRLGVKLKVQPINWDSKDQELNTGNIDCIWNG
FSINEERKENILFSDPYMKNNQVVVVMADSEYNTFGDLKGKSVSLQAQSSASDALAKNAE
FKNSLKDVIELKDNTLCLMDLKTGNTDAVVMDEVVARYQIQMNSEKYRMLGESLAAEEYG
VGFRKGDVKLMTKVNDTLKEMAKDGKITEISNKWFGKDISIVEK
Download sequence
Identical sequences B8I8M4
394503.Ccel_0885 WP_015924417.1.84728 gi|220928328|ref|YP_002505237.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]