SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 395492.Rleg2_5236 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  395492.Rleg2_5236
Domain Number 1 Region: 6-189
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 2.48e-49
Family Methylesterase CheB, C-terminal domain 0.0000912
Further Details:      
 
Weak hits

Sequence:  395492.Rleg2_5236
Domain Number - Region: 230-258
Classification Level Classification E-value
Superfamily YfgJ-like 0.0085
Family YfgJ-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 395492.Rleg2_5236
Sequence length 334
Comment (Rhizobium leguminosarum bv trifolii WSM2304)
Sequence
MPSSATKDIIAIGGSAGSGAVLQALVADLPADFPAAVLISTHIPSNSPGFLAQVLAAKSK
LPVTQAVDGQPIERGHIYLAAPDRHLLLIGETIMFGAGPRENMARPSIDPMFRSAALSFG
PRVVGLVLTGMLNDGAAGLHAIKSNGGTAVVQHPLDAEADQMPLAALEAVEVDHVASAAD
LGRLLIDIAGTSAGPALDSPSDELRLEVEIAAGARTGSVELRKIASPTAITCPDCHGVLS
EVRGSGPLRYRCQIGHAYTADALAAHIDELDEAIRIALRVMEERVTLVERMARDARETGR
TAVAELYEARAAEYRRYSATLHEAALTSLRLGNA
Download sequence
Identical sequences B6A1E2 I9XAS2
gi|209547248|ref|YP_002279166.1|NC_011368 gi|209547248|ref|YP_002279166.1| 395492.Rleg2_5236 WP_003591041.1.20038 WP_003591041.1.84753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]