SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 395495.Lcho_0980 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  395495.Lcho_0980
Domain Number 1 Region: 3-265
Classification Level Classification E-value
Superfamily PHP domain-like 0.000000000000902
Family PHP domain 0.011
Further Details:      
 
Weak hits

Sequence:  395495.Lcho_0980
Domain Number - Region: 992-1072
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0728
Family Single strand DNA-binding domain, SSB 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 395495.Lcho_0980
Sequence length 1188
Comment (Leptothrix cholodnii SP 6)
Sequence
MSFVHLRTHTEYSVVDGTLRIDEIVKTAAKDGQPALAITDLANLFGAIKFYKEANKRGVK
PIIGADIWLEPEGIGAAGEVRPATRLLLLVQNEPGYLNLCEILSRAWVQNVQRNQAWVKW
EWLDELNGGLIALSGGLMGCVGQSLAQGDTVRAAELARKLAAIFPRRFYLEVQRAGLPGH
DALVLATVPLAAQLQLPVVATHPIQYLAPDDFDAHEARVCVAEGETIANPKRPRRFGRDQ
HFKTQAEMEALFADVPTALANTLEIARRCSLRLVLGKPQLPNFPTPTLADGSSMPMEDYF
RQLSYEGLEERLALLYPKPEKRDAERARYLERLEFELTTILKMGFPGYFLIVSDFIRWAK
ANGCPVGPGRGSGAGSLVAYVLSITDLDPLHYNLLFERFLNPERVSMPDFDIDFCQGNRD
RVIDYVKDRYGRPAVSQIATFGTMAAKAALRDIGRVLGMGYGHVDSIAKLIPAPPGKSVT
LARVPEKAEDRDGGVIYARLEAPELEEREKNEEEVAELLSLAMRVEGMVRNIGMHAGGVL
IAPGKITDFCPLYQQPGSDSAVSQYDKDDVEAIGLVKFDFLGLATLTILELAKEFIVARH
ENRKDFAFETIPLDDAAVYKLFSDGLTEAVFQFESGGMQRMLKDAKPSRLEDLIALNALY
RPGPMDLIPSFVARKHGKEPVEYPHPMVEWVLSETYGIMVYQEQVMQTAQVLGGYSLGGA
DMLRRAMGKKKAEEMAEHRAIFRKGAAGNNISQDKADEIFDLMEKFAGYGFNKSHAAAYS
LLAYHTAWIKVHHTAEFFAANMTIELDDTDKLRVLRQDALKFGVQFESPDVNVGVYRFEP
APGKAGNKLIRYGLGAIKGTGQGAIEAIIAARNEGGPFRSIFDFCARVDRKSINKRVIEA
LVKAGAFDKLHPKGLDGRAELLASVGLALEYAGTQAAHADQSGLFDFGGGDDHGSSTREP
DYVAAETWDVKQRLSHEKIAIGYFLSGHLFDQVAAEVRQFAKRRIEDLSDSRDPQTLAGI
VTDLRIVNGHRGKVAIFKLDDKTAAIEAVVAEELLNANAALLKDDELLILQGKAQPDRFS
GGVRFNVIQILDLPTARCRHGRYLRVPATDNLPPVDQVLRDFPARSISTEHGELVQGVPI
RLVVERESACGEVDLGEAARFYPSDEALKLWQVGSQGKARLVYSEEQA
Download sequence
Identical sequences B1Y2N5
395495.Lcho_0980 gi|171057667|ref|YP_001790016.1| WP_012346013.1.27902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]