SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 395495.Lcho_3443 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  395495.Lcho_3443
Domain Number 1 Region: 1-114
Classification Level Classification E-value
Superfamily CheY-like 4.84e-34
Family CheY-related 0.00029
Further Details:      
 
Domain Number 2 Region: 115-212
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 8.5e-21
Family PhoB-like 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 395495.Lcho_3443
Sequence length 213
Comment (Leptothrix cholodnii SP 6)
Sequence
MRVLLLEDDIDLGQAVDDHLEAAGHSVYWCKLVSQVRNVTFDLALVDLNLPDGDGVDLVR
YWRQAGRLTPVIMLTARDQVSDRIRGLQAGADDYLVKPFDLDEMLARIDAVLRRSSPSPR
LQVHDNVVDLEQRQVLHQGQPLDLTAMEWAVLRCLASRPGRIFNRGEIDVALAADGQPSS
DSNTLEVIVSRLRKKLGADVISTHRGMGYRLDV
Download sequence
Identical sequences B1Y345
gi|171060117|ref|YP_001792466.1| 395495.Lcho_3443 WP_012348448.1.27902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]