SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 395960.Rpal_1421 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  395960.Rpal_1421
Domain Number 1 Region: 6-179
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.09e-28
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 395960.Rpal_1421
Sequence length 186
Comment (Rhodopseudomonas palustris TIE 1)
Sequence
MSTSRIELRFGGTGGQGLLLSAKLLADALALEGRHVAQSQTYEPTSRGGFCNADLVVAHG
EVDYPLPIEFDHLVLLDKIAIKPSWPKLKAGALVISDVRLCPELPEGGRFKRYPLPLSRT
AIELGSERVTNIVALGVLIELSGICKHKSVEQVVRASSPRGFLDLNMDALAAGYALAKTP
AVAAAS
Download sequence
Identical sequences B3QJ79
gi|192289831|ref|YP_001990436.1| 395960.Rpal_1421 WP_012494910.1.13849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]