SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 395961.Cyan7425_1941 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  395961.Cyan7425_1941
Domain Number 1 Region: 7-109
Classification Level Classification E-value
Superfamily SpoIIaa-like 7.65e-24
Family Anti-sigma factor antagonist SpoIIaa 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 395961.Cyan7425_1941
Sequence length 114
Comment (Cyanothece PCC 7425)
Sequence
MSLRGSRELRDTYQLFRLTGLMDAFSEPMFRKVLNKYIEDGPPHIILDLSKIDFVDSSGL
GVLVQLAKKAQTSGGSLQIVTNPRVTQTVKLVRLEKFLALQPDLDTAISNVPQG
Download sequence
Identical sequences B8HT80
395961.Cyan7425_1941 WP_012627391.1.77409 gi|220907356|ref|YP_002482667.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]