SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 395961.Cyan7425_3119 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  395961.Cyan7425_3119
Domain Number 1 Region: 3-188
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.31e-54
Family Methylesterase CheB, C-terminal domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 395961.Cyan7425_3119
Sequence length 337
Comment (Cyanothece PCC 7425)
Sequence
MPYRDIVVIGASAGGVEALTQLVAPLPIDLPATLLLVVHLSATAYSALPQILSRAGPLPA
LHPQDQQPLQPGQIYIAPPNVHLFLRSGRIGLSRGPRENGFRPAVDVLFYSAAQVYTQRV
IGIILSGALDDGTAGLAMIKAHGGVALVQDPLEAAFGGMPGSAIANVQVDHILKVRDLAS
CLEKLVHETVTEEPVMSNFKLESEAEIVAQDKANLEAGQRPGQPSPLTCPGCGGVLWELR
DGDIVRFRCHVGHAYSIESLQDEQRNSVEVALWSAVRALEEKAALSRRMMVKFRAQNSPI
SALHFQERAQQAENQAELVRQVLAAQQNGRSQPVMQE
Download sequence
Identical sequences B8HMX8
WP_012628510.1.77409 gi|220908497|ref|YP_002483808.1| 395961.Cyan7425_3119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]