SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 395962.Cyan8802_1677 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  395962.Cyan8802_1677
Domain Number 1 Region: 83-368
Classification Level Classification E-value
Superfamily PLP-binding barrel 2.06e-62
Family Alanine racemase-like, N-terminal domain 0.0041
Further Details:      
 
Weak hits

Sequence:  395962.Cyan8802_1677
Domain Number - Region: 461-533
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 0.00101
Family Eukaryotic ODC-like 0.016
Further Details:      
 
Domain Number - Region: 13-55
Classification Level Classification E-value
Superfamily Actin-crosslinking proteins 0.0108
Family Histidine-rich actin-binding protein (hisactophilin) 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 395962.Cyan8802_1677
Sequence length 681
Comment (Cyanothece PCC 8802)
Sequence
MKETLQLETSPLNNSKKTSTWTIENSENLYYIKGWGEPYFSINAAGHITVSPQGDLGVSL
DLYELVQSLKKRNISFPLLIRFSDILADRLARLNASFDRAIARYNYPNKYQGVYPIKCNQ
HRHIVETIVNYSKSYQFGLEAGSKPELMIALATLDPSLIAPNYAPIIICNGYKDPAYIKT
AILATQLGYKPIIVIEQLEELFLTLEISKQLGIEPSLGVRAKLSTKGSGRWGNSTGDRAK
FGLTIPEILTVVEYLKSEENLHYLQLLHFHIGSQIASISVIKDAIREASQIYIQLAKVNP
NMQYLDVGGGLGVDYDGSKTNFYASKNYNMQNYANDIVAEVKESCEAANIEAPILISESG
RAIAAHHSVLIFDVLNTNNVCTTPPQLVEEKENLIIRNLRQTYESIDVQNYQEMYHDAIQ
FKEEAISLFNFGYLSLGERAKAEQLYWACCQKILEITRHQEYVPDDLEDLEKTMASIYYI
NLSVFQSAPDSWAIDQLFPIMPIHRLDEEPTQRAILADLTCDSDGKIDQFIDLRDVKSVL
ELHPLKTLENQQDTIPSKSENINPENNSTEPYYLGMFLVGAYQEIMGNLHNLFGDINVIH
ISMSSKGYQIEHLVKGDTIKEVLSYVQYDAEALLESMRQRTEKALQDHRLTLEESQQLLQ
DYEENLNDYTYLASAQAKLKP
Download sequence
Identical sequences WP_015783768.1.62203 395962.Cyan8802_1677 gi|257059529|ref|YP_003137417.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]