SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 395962.Cyan8802_3244 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  395962.Cyan8802_3244
Domain Number 1 Region: 61-150
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 3.14e-21
Family Ribosomal protein L9 C-domain 0.00063
Further Details:      
 
Domain Number 2 Region: 5-58
Classification Level Classification E-value
Superfamily L9 N-domain-like 6.98e-16
Family Ribosomal protein L9 N-domain 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 395962.Cyan8802_3244
Sequence length 152
Comment (Cyanothece PCC 8802)
Sequence
MAKRVQIVLNKTINKLGQTGDLVEVAPGYARNYLIPQGMGVIATPGILRQVEQRKEKEMQ
RLLAEKQAAEARKVALSTIGRFTIRKQVGEGEAIFGTVTTQEVADAIQAATNQEVDRRGI
TLPEISQTGFYKATVKLHPEVTAEIEIQVAPL
Download sequence
Identical sequences gi|257061029|ref|YP_003138917.1| 395962.Cyan8802_3244 WP_015784602.1.62203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]