SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 395962.Cyan8802_4048 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  395962.Cyan8802_4048
Domain Number 1 Region: 131-319
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 2.32e-51
Family ATP-binding domain of peptide synthetases 0.0000363
Further Details:      
 
Domain Number 2 Region: 1-129
Classification Level Classification E-value
Superfamily PreATP-grasp domain 6.62e-38
Family Prokaryotic glutathione synthetase, N-terminal domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 395962.Cyan8802_4048
Sequence length 334
Comment (Cyanothece PCC 8802)
Sequence
MKLAFIADPLPRLDPTHDSTVAMMEAAQVAGHEVWITEIHQLNVIEGKAWATLYQVQLTP
ITLQGEKWVAVPNWYAISEGVLMCLEDMDAVFMRKDPPVNVRYIYATYILELINPDKTLV
INSPQGLREANEKMYTLQFYSLMAETVVSRDKAVIRKFVDEKGLAVLKPLGGKAGEGILM
LETSDRNFNSIIEVSTDYGKEPVMVQRFIPEAKDGDKRIILLDGQPIGAVNRVPTGKEFR
GNMAVGGRIEKTKISPREAEICATIASKLQKDGLYFVGIDVIGGYLTEVNVTSPTCIREI
DLLDGTNLGKKVIEWVEKKVNKREEAGGRRQEDG
Download sequence
Identical sequences 395962.Cyan8802_4048 WP_015785035.1.62203 gi|257061792|ref|YP_003139680.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]