SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 396513.Sca_0013 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  396513.Sca_0013
Domain Number 1 Region: 2-362
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 5.76e-98
Family Homocysteine S-methyltransferase 0.00000567
Further Details:      
 
Domain Number 2 Region: 318-602
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 4.51e-66
Family Methylenetetrahydrofolate reductase 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 396513.Sca_0013
Sequence length 613
Comment (Staphylococcus carnosus TM300)
Sequence
MSRFLQTLKENVLVADGAIGTILYSEGIDTCPEAYNITHPKKIEQIHRSYIQAGADVIQT
NTYGANFEKLQTFGLEHQVKDITRAAVRIAKKAANEDTFILGTVGGFKGVKQNELSLSTI
LYHTDIQIDTLIDEGVDALLFETYYDLNELLQVIRATKKKYDIPVIAQLTASNTNYLQDG
TEINEALKQVEAEGADVIGLNCHHGPHHMQQSFTHIELPQHALLSCYPNASLLDFENSSI
KYSDNASYFGKIAKSLVKEGVHLIGGCCGTTPEHIHYIKEAVEGLEPINEKKVIPIRRKS
NHPSIPVQKDNLTTKVKSGPTVIVELDTPKHLDTTKFFVNVTKLDKANVDAITLADNSLA
TVRVSNIAAASIIKQNYNIEPLVHITCRDRNLIGLQSHLLGLSLLGINEILAITGDPSKV
GHLPGANNVYDVNSKGLTELAVRFNQGLNIDGGALKTTTNFNIAGAFNPNVRKMEAAVRR
LDKKLDSGMNYFITQPVYTVEKIQEIAEKTAHLDSPFFIGIMPITSYRNAQFLHNEVPGI
TLPEDVLEQFEAVKDDKQKTKELSLRICRKLVDEVTKHFNGLYLITPFEQVDYSLELATY
FKTKTENNQEAII
Download sequence
Identical sequences B9DIA5
gi|224475507|ref|YP_002633113.1| WP_012664043.1.31717 396513.Sca_0013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]