SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 397948.Cmaq_1400 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  397948.Cmaq_1400
Domain Number 1 Region: 1-205
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.56e-53
Family Phosphate binding protein-like 0.000072
Further Details:      
 
Domain Number 2 Region: 211-282
Classification Level Classification E-value
Superfamily GlnB-like 1.78e-17
Family ATP phosphoribosyltransferase (ATP-PRTase, HisG), regulatory C-terminal domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 397948.Cmaq_1400
Sequence length 283
Comment (Caldivirga maquilingensis IC-167)
Sequence
MAIPSKGRLVEPVMSLLNYVGIKPQSMDDRALVLPTSWRSLSLIRIRPEDIPSVVESNSA
IMGITGLDYVVENGASVNVVERLGFGRGRIVIAVPSGSGISSIDEIKDGFRLATKYVNIT
SAYFSKLGRRVRIVRISGSAEVMPLLNVADGIVDVMSTGTTLRLHGLKPIGVIMESEAVL
VTPRELNGDEREFVDKFLILMRGALASNGRKLILMNVPEEDLAAVLKVLPAMEGPTVADV
ASGKPMKEVISVVPEESIPDLLPLLKRAGAKDILVLSIEKVIP
Download sequence
Identical sequences A8M907
gi|159041964|ref|YP_001541216.1| WP_012186445.1.60673 397948.Cmaq_1400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]