SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 397948.Cmaq_1544 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  397948.Cmaq_1544
Domain Number 1 Region: 6-476
Classification Level Classification E-value
Superfamily L-aspartase-like 2.12e-143
Family HAL/PAL-like 0.000000248
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 397948.Cmaq_1544
Sequence length 497
Comment (Caldivirga maquilingensis IC-167)
Sequence
MTVEIGERINLVDVVNVARNHEEVKVSERALNLMNKSLDVLEKAVNSGIKIYGVNTGLGD
LHNVTVNPEDVARYSLEMLIDHSMGVGDYAPDDWVRATMLIRAHQLSLGYSGIRGRIIER
LIQFLNLNITPLVPKYGSVGASGDLAPLAHIALALLGKGLVKYRNEVMNSAEVFKALGLD
ELRLGYKEALSLINGTSYSAALASLGIWDAYTLIRAAMAIIILMIEASRASIRPLSIEVN
SIKLHYGEVEVARIIQESLSDSANVNTSGRVQDPYSIRCIPQVIGPIMDALSWSLRNIMN
EVNSVSDNPVIINDNVYSTCHFHGQYLALSTDLLNTSLSTLGNLLERQIAQLMRREINNT
SNYLANGPWRIGLMLTQYAAAALTARLRELASPSIIHNIPTSGLQEDVNSMSVNSAIKLH
EVNSLMKWLISLLAYVSYSVINANNGCVNCGKVSMHVYDIINRYVTGSQSHHEAVAKLTN
SINELASLINLKIDHLA
Download sequence
Identical sequences A8M9E8
WP_012186586.1.60673 gi|159042105|ref|YP_001541357.1| 397948.Cmaq_1544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]