SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 397948.Cmaq_1863 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  397948.Cmaq_1863
Domain Number 1 Region: 7-184
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.4e-47
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 397948.Cmaq_1863
Sequence length 187
Comment (Caldivirga maquilingensis IC-167)
Sequence
MEGLSRIDITFYGRGGQGAVTAAQVLAEAAIHSGLFASAFPEYGAERRGAPVRAYVRVAN
QYLGIREPIEKPDVSVVFDTRLIDVFNITKITKPNGTIVINSSEDYAKQMLSQFNGKVVY
VDAYGISMKYLGKAIVNTPMLGALLRVIGMINIEVVKELIRNTFRGRIGQLNAEAIDEAY
KLARVIP
Download sequence
Identical sequences A8MB51
397948.Cmaq_1863 WP_012186899.1.60673 gi|159042418|ref|YP_001541670.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]