SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 398527.Bphyt_6534 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  398527.Bphyt_6534
Domain Number 1 Region: 15-94
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 0.00000000000000182
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 398527.Bphyt_6534
Sequence length 130
Comment (Burkholderia phytofirmans PsJN)
Sequence
MFRKLQDPSLADTLQITVDGEAVGAMEGETVAGVLMRRAVLLTRQTPVSGMLRAPYCMMG
VCFECLAVVDGIASVQTCLTTVRDGMCVERQRGRRTVELEVCSGRDFTEDGEREAAPPRE
DEAVRDEKKI
Download sequence
Identical sequences B2TB95
gi|187921176|ref|YP_001890208.1| 398527.Bphyt_6534 WP_012428341.1.30149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]