SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 398578.Daci_5941 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  398578.Daci_5941
Domain Number 1 Region: 668-1115
Classification Level Classification E-value
Superfamily ALDH-like 8.38e-126
Family ALDH-like 0.000000281
Further Details:      
 
Domain Number 2 Region: 259-614
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 4.71e-118
Family Proline dehydrohenase domain of bifunctional PutA protein 0.000000000118
Further Details:      
 
Domain Number 3 Region: 88-258
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 2.09e-60
Family N-terminal domain of bifunctional PutA protein 0.00000112
Further Details:      
 
Domain Number 4 Region: 3-44
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.00000000473
Family PutA pre-N-terminal region-like 0.0018
Further Details:      
 
Weak hits

Sequence:  398578.Daci_5941
Domain Number - Region: 1128-1295
Classification Level Classification E-value
Superfamily ALDH-like 0.0619
Family ALDH-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 398578.Daci_5941
Sequence length 1345
Comment (Delftia acidovorans SPH-1)
Sequence
MSTTVGIKVDDALRERIRIAAQQIGRTPHWLIKQAVVQYVDALERGATTIRLSSAGDSQG
DVALEEAQPSSPQEVQPFLEFAQSILPQTPLRAAITAAWHRPEPECLPVLLPLARAQDAQ
QADKVRELATRLVQGLRDAPAGSGVAALVQEFSLSSQEGVALMCLAEALLRIPDRATRDA
LIRDKISKGDWRAHVGRSPSLFVNAAAWGLVLTGKLTSTSSEKNLSSALTRVIGKGGEPL
IRQGVHRAMKLMGEQFVTGQDIAEALANSRAYEKQGFRYSYDMLGEAAATDSDAQRYLQA
YEQAIHAIGAASNGRGIFEGPGISIKLSALHPRYSRAQYERVMAELLPRVLQLAELAKQY
DIGMNIDAEEADRLELSLDLLEALCAAPSLKGWNGIGFVVQAYQKRCPQVLDYLVDLARR
SRRRLMVRLVKGAYWDSEIKRAQEGGQAGYPVYTRKVYTDVSYLACARKLLDAPDAIYPQ
FATHNAQTLASIYHLAQAVGGSYYSGQYEFQCLHGMGEPLYAQVTGPASEGKLARPCRIY
APVGSHETLLAYLVRRLLENGANTSFVNRIGDASVPVSDLVADPVDEVMKIARNEGRLGA
PHPRIALPADLFAQQGDKPGQARANSQGLNLAHEQQLASLAAALLHSTRQTYLAAPADAD
LPADPARTEGWQPMRNPAELSDIVGWVREATAAEAEAAAARAAQAAPIWAGTPPAARADA
LARAADLLEQRSQPLMGLIMREAGKTLSNAVAEVREAVDFLRYYGAQAAAHFDNAAQRPL
GVVLAISPWNFPLAIFCGQVAAALAAGNTVLAKPAEQTPLTAAAMVALLHEAGVPRDALQ
LVPGTGETVGAALVAHAQVAGVMFTGSTEVARLIARQLSRRLSPAGRTIPLIAETGGQNA
MVVDSSALAEQVVADVLASAFDSAGQRCSALRLLCLQDEVADRTLTMLRDALQEWNLGNP
DRLSTDVGPVIDDAARRQIEQHIEQMAAAGQKVTRVERKDGVLNGHYVAPALIEIDSTTR
LQREVFGPVLHVIRFKREQLDALVDGINATGYGLTFGVHSRIDETIAHLTQRVHAGNIYV
NRNVIGAMVGVQPFGGMGLSGTGPKAGGPLYLHRLAQGPASAALSVFARAESSAQAPLQL
LGLLRETLSKAPPQDMSADEQVQALAACDEALAASRLDAAMLLPGPTGESNRYRLLPRGP
VWALPRTPLGLVAQVAAALASGNACHAVLPDNGTGADSGCAATWQALRAAAGDAGVPWLH
SASAESLADAQAPMAALLFEGDGDALLQVCAQVAARDGALVRVESRNSDELHAGRGYDLA
ALFHEQSISTNTAAAGGNAQLMTMA
Download sequence
Identical sequences A9C1A6
398578.Daci_5941 gi|160901372|ref|YP_001566954.1| WP_012207738.1.82428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]