SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE006777 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39946.BGIOSIBCE006777
Domain Number 1 Region: 244-341
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000235
Family B3 DNA binding domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE006777
Sequence length 347
Comment (Oryza indica)
Sequence
MNLVRLERGSDNIPREIASVVSQKFTFCVSVTERSFMQRNIAFQVNSIETSLADKALFHS
ICRESECPDHTSTPPASSNTPVGDMEKAHADSRKRCPIMRLPLGASKKLTFEVGASEGKD
IDTAVVSERQWTPLNQVLSYVLCSCSVILVHAKIYLFFSADTAMNPPRFFTVRLTTANQR
YVCRPAAIAQGYQLEDGQRLKLVTTHNLMATPNALSMKCASAPGRDINLSTELKDYIKDI
AQFLHPSNKFYVTTINPTFMKQDKVHFSKQFSMTYIALIVRKKTSQIEVRIPGHSSTTMV
LHHSTEKRFNLKSGWTHFPTSNGIQVGTICIFHFHQTNQLQATIDVL
Download sequence
Identical sequences 39946.BGIOSIBCE006777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]