SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE008924 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39946.BGIOSIBCE008924
Domain Number 1 Region: 268-462
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.09e-35
Family cAMP-binding domain 0.0000124
Further Details:      
 
Domain Number 2 Region: 68-268
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000000011
Family Voltage-gated potassium channels 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE008924
Sequence length 559
Comment (Oryza indica)
Sequence
MFGAGKVDDEMALKRQRTVRFYDEKAKPTIPTHQKQAGFAASKLGVASSGKNKIFVPGEE
LWYKRILDPSSDFILTWNHIFLFSCFVALFIDPLYFYVPKISYGTPNSCIGTDRHLAITV
TFFRSISDLLYFTHIIIKFRTAYINPSSTMRVFGRGDLITDPKEIAWQYLRSDFVVDAVA
ALPLPQILIWFVIPAIKYSTDEHNNNILVLIVLAQYFPRLYLIFPLTYEIVKTTGVVAKT
AWQGAAYNMLLYMIASHTYLQSITVRVEEWRLKQRDTEEWMRHRQLPHELRERVRRFIQY
KWLATRGVNEESILQALPADLRRDIKRHLCLGLVRRVPFFSQMDNQLLDAICERLVSSLC
TQGTYIVREGDPVTEMLFIIRGKLESSTTNGGRTGFFNSTTLKSGDFCGEELLGWALVPK
PTVNLPSSTRTVKALIEVEAFALQAEDLKFVANQFRRLHSKRLQHTFRYYSHHWRTWASC
FIQAAWRRYKRRKMARDLSMRESFCSMRSDDSNGEDDSPPKQNLSMKIMSGSRKGPQNMK
ELPKLRKPDEPDFSAEPCE
Download sequence
Identical sequences 39946.BGIOSIBCE008924 OsIBCD008212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]