SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE009434 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39946.BGIOSIBCE009434
Domain Number 1 Region: 34-125
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.67e-29
Family B3 DNA binding domain 0.0000214
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE009434
Sequence length 308
Comment (Oryza indica)
Sequence
MEFITPIVRPASAAAGGGEVQESGGRSLAAVEKEHMFDKVVTPSDVGKLNRLVIPKQHAE
KYFPLDAASNEKGLLLSFEDRTGKPWRFRYSYWNSSQSYVMTKGWSRFVKEKRLDAGDTV
SFGRGVGEAARGRLFIDWRRRPDVVAALQPPTHRFAHHLPSSIPFAPWAHHHGHGAAAAA
AGARFLLPPSSTPIYDHHRRHAHAVGYDAYAAATSRQVLFYRPLPPQQQHHPAVVLESVP
VRMTAGHAEPPSAPSKRVRLFGVNLDCANSEQDHAGVVRKTAPPPLPSPPSSSSSSSGKA
RCSLNLDL
Download sequence
Identical sequences A0A0E0GBA1 A2XBV3
39946.BGIOSIBCE009434 OsIBCD038424 ONIVA02G30750.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]