SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE009945 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  39946.BGIOSIBCE009945
Domain Number - Region: 148-233
Classification Level Classification E-value
Superfamily PH domain-like 0.0664
Family GRAM domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE009945
Sequence length 264
Comment (Oryza indica)
Sequence
MHPPAAAGGDHATATPAPATGAAAATASDYAHYPRLSPEDVAPPPPPPYHAAASSAPPYS
GNPYVSSPAGGVAPASKNTMDTVKDVLGKMGKRFGEAARKTETLTGNFWQHLKTGPSITD
AAMGRVSQITKVIAEGGYDKIFHQTFDVLPDEKLKKPYACYLSTSAGPVMGVLYLSNKKL
AFCSDNPLAYKVGDKDEWSYYKVVIPHTQLRSVNPSTSRTNASEKYIQVVSVDNHEFWFM
GFVYYDSAVKNLQEALQEAQNLRA
Download sequence
Identical sequences A0A0E0G2A2 A0A0E0NQS5 A2XDC7
ONIVA02G06440.1 39946.BGIOSIBCE009945 OsIBCD009103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]