SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE013940 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39946.BGIOSIBCE013940
Domain Number 1 Region: 110-242
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.35e-18
Family Voltage-gated potassium channels 0.0035
Further Details:      
 
Domain Number 2 Region: 240-316
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00000113
Family cAMP-binding domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE013940
Sequence length 432
Comment (Oryza indica)
Sequence
MASADAILSSQVAGECLKINKVSLVVNVFFAIDIAISFFVTYRDTSNCLLITDRRKITTS
LSLAKDKDYGGSSIFSVSGDYGVPASSLQGWRRTSDSAICGLGLSSSFVIWMQVTLFALH
FAACIYLWMVFNYKIKELTWIGSQIHSFEDRSVWFCYTCAVYWSITMLATVGYGDLHATN
IGEMLFSIAFMLFNMGLTSYIIGNITNLVVRETSNTFKMRDMVQRVSEFGSMNWLPEEAL
TTLADGIQEALTTLADGTEKHVKRIGPRGMVGEIGVMFSIPQPFIIRSRRLTQVVRISHI
HLLQAVRPNTADGCIVFSNFILVSDFVENGNSTVLGRATEVAVDESKEAAHKMLPCKEPK
RVVIHEQLPNETGTTLHPSPGKLVLLPDSMQELMKLSEKKFGKAARGILTVEGAEVEDID
VIRDGDRLFFSL
Download sequence
Identical sequences 39946.BGIOSIBCE013940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]