SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE017066 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39946.BGIOSIBCE017066
Domain Number 1 Region: 296-401
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000301
Family B3 DNA binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE017066
Sequence length 442
Comment (Oryza indica)
Sequence
MADTRGSTSSGGGDDRGREGHDDFTGGGQYNRYHRILEAVPSPLVRSENVVHHQYPTGLI
HHPSSTMPVAPCSYVPRYTMVPTSAMLPLQHHHRQLQISQENFQDRVPSNNVAAPHLPSN
FQDLRPMCNGPPFMSYGQTASNRNVLYQNLTPYSFNAWASNNMPRNPVYTSYHPTAIEDP
HATPFHINNHDTDQGFFTVSTSFRVDQSFVHAPSPFPPVSSSSRSFSSAQISNGPTDAKK
AKKSDIKDQPIVLRRSDTESEKNDELNQTPASEPSSMSHNSANSTIRFNCREYRVILRKE
LTNSDVGNIGRIVMPKRDAEAHLPALHQREGVMLKMDDFKLETTWNFKYRRYLSGSGPTT
RAEFCTGADELLSLGGFVKQHGLQTGDIFIIYKSSESEKLVVRGEKAIKPNVIMPIVDCS
CKNDLNNSEECGFAISLLTKKT
Download sequence
Identical sequences OsIBCD016007 39946.BGIOSIBCE017066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]