SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE017067 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39946.BGIOSIBCE017067
Domain Number 1 Region: 367-463
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.59e-19
Family B3 DNA binding domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE017067
Sequence length 504
Comment (Oryza indica)
Sequence
MADARGSSSSSGDGGGGEGNGGAGHGDFVGGGQHNWYHGILGAVPPPNVGRQNIVHHQYP
AASLIQQHHQSPTMPLPMAQLPYVPQYTVLPTPAVLPSHHHHHGQSQISQENFQDWVPSN
NVAAPHVPSAFQDWRQMCNGSAFMPFGQTAANSNVFYQNLTFNSWTSNNMPRNPVYTSFH
PAAIEDHHAPLFHSNNHDIDPEFLGNRHLHGVDIAGAPPAKATSPATAGGLLTNTAPATV
SQIHARCRRRQIYRCCGLLPRAPPPSDPCAFARAAITAARSARGLLSHLYGGLVFWLVGK
RKLGEKRERKRKVVAEMDPPIVFRRSDMESEKNDDNPDQTPVSEPPSMNQNGENLIIRFN
CREYRVILRKELTNSDVGNIGRIVMPKRDAEAHLPALHQREGVTLKMDDFKFETTWNFKY
RFWPNNKSRMYVLESTGGFVKHHGLQTGDIFIIYKSSESEKFVVRGEKAIKPNAIMPVVD
CSCKNELNKSEECGFTISLQTKKT
Download sequence
Identical sequences OsIBCD016008 39946.BGIOSIBCE017067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]