SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE020388 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39946.BGIOSIBCE020388
Domain Number 1 Region: 90-165
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 3.92e-27
Family Skp1 dimerisation domain-like 0.0002
Further Details:      
 
Domain Number 2 Region: 11-72
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000000549
Family BTB/POZ domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE020388
Sequence length 166
Comment (Oryza indica)
Sequence
MAAAAEEKNKKMIKVISSDGEAFEMTEAAASMSRILLHMIEDGCTGDGGAGITLPNVAGS
ALAKVIEYCTKHAIAAAEGSSSSRKAKEELKKFDVEFMEVGIDMLYDLIMAANFMGVEGL
LSLAAQRTAELIKGKSPEQIREMFGIKNDHTPEEEEQIRKEYEWAF
Download sequence
Identical sequences A2Y8I6 Q9LWT8
OsIBCD041577 39946.BGIOSIBCE020388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]