SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE020930 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39946.BGIOSIBCE020930
Domain Number 1 Region: 253-440
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.14e-26
Family cAMP-binding domain 0.0000268
Further Details:      
 
Domain Number 2 Region: 58-246
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000000000761
Family Voltage-gated potassium channels 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE020930
Sequence length 531
Comment (Oryza indica)
Sequence
MELRKQRTVRFHEERAKPTIPTHQKQAGLATSKLGLGISEKNKIFLAGNELWYKKIIDPS
SDFILTWNYVLRIACFVALFMDPLYFYVPKIYYGTPNSCIGRDTRLAIIVTVFRSITDLF
YVLQIIIKFRTAYINPSSTLGVFSRGDLVTDPGNIAKHYLRSSFVVDLVASLPLPQIIIW
SVIPSVKYSLSEHDDDILLLIALFHCYGQTLTVSTYIGETLYAIFLAVLGLVLFAHLIGN
VQTYLQSITARVEEWRIKQRDTEEWMRHRQLPQKLRERVRRFVHYKWLATRGVDEESILK
ALPADLRRDIKRHLCLDLVCRMDGQLLDAICERLVSSLSTVGTYIVREGDPVTEMLFIIR
GKLESSTTDGGRTGFFNSITLKTGDFCGEELLGWALVPKPTVNLPSSTRTVKTIVEVEAF
ALRAEDLKFVASQFRRLHSRKLQHTFRYYSHHWRTWAACFIQAAWRRYKRRRLAKDLSIR
ESFFSRRSFEDDGSPEHSLVLNAVRKGAHIIKELPKFRKPSEPDFSAEHDD
Download sequence
Identical sequences OsIBCD019658 39946.BGIOSIBCE020930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]