SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE020968 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39946.BGIOSIBCE020968
Domain Number 1 Region: 125-223
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.92e-24
Family B3 DNA binding domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE020968
Sequence length 230
Comment (Oryza indica)
Sequence
MAEAASYEEQRRRQVEANKRKLEELRLHHLSAAVRESAAKPSPVKQRKRKARALPGAGED
APLRRSGRVANLPEKPKYRDEFQDFEKRIRRSYGGKRRDLSNRVYATDEQRDYAINAAQE
LEEELGSDYPIFVKPMLQSHVTGGFWLSLPTHFSRKYLPKRDETIRLVDEEDDEFDTLYL
ANKRGLSGGWRGFSIAHKLVDGDCLVFQLIQRTKFKVYIIRASSYYETDD
Download sequence
Identical sequences A2YA88
39946.BGIOSIBCE020968 OsIBCD019696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]