SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBSE038063 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39946.BGIOSIBSE038063
Domain Number 1 Region: 263-420
Classification Level Classification E-value
Superfamily Nucleotide cyclase 7.06e-44
Family GGDEF domain 0.0000677
Further Details:      
 
Domain Number 2 Region: 455-543
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.69e-22
Family Nitrogenase iron protein-like 0.001
Further Details:      
 
Domain Number 3 Region: 580-707
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 1.83e-21
Family Single-domain sulfurtransferase 0.028
Further Details:      
 
Domain Number 4 Region: 150-232
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000549
Family Anti-sigma factor antagonist SpoIIaa 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBSE038063
Sequence length 744
Comment (Oryza indica)
Sequence
MGSGFCGSFATSASFSRSAINLYAGAKSGWATLFALALVLAVLLWLTPALYHVPQSVLAA
VVVAAVISLIKPAVLLRLWRISRVEALIGGLTFLLTLATAPRMYWGVLAGLVLNLSHFLY
QRLHPRIIEVGLHPDGSLRDRHLWQLPPLAPGLLGVRMDAELDFASAAALEQRISEHLAA
YSEVRHICLFALPINRIDVTGVECFGRLRALARTHGGALHVSGMKLPVEQALGSEAAIPR
ESPRHYLQGLIDGLCELSLKDPLTGLANRRHFRTVLEREIDRVTRAGEAALLLMLDIDNF
KRVNDTHGHMAGDIVLQSIARTLSRCVRPMDTLSRYGGEEFAVVLPACQAGFGKVVAERI
RRAVERTPVRISPTVELNVTVSIGGAFALQWIRSTTLLWTERADSQLYKAKLAGRNRVSI
EEQPDSTAAPIESKEMTDALSPRTTPAAPQAPAGARIIAITSGKGGVGKTFVSANLAAAL
TRRGYRVLVLDADLGLANLDVVLNLHPNVTLHDVFVGKAELDDAGTILLAEEGINMFLAG
PAHAVRGFVQWLRDADARFAALEPKESWSASQPFRKMLVKVKREIIRMDHPAIRPAEGRA
PSVDAPTLRRWLAQGHDDTGRPVVTLDTRNAFEVDHGTFEGAIDWRIGKFTEFPPALRAH
KAELEGKTVVSFCTGGIRCEKAAILMREEGIGHVYQLEGGILKYFEQTDGAHYRGGCFVF
DEREVLAPDLSESGSGPVDGPASA
Download sequence
Identical sequences 39946.BGIOSIBSE038063 OsIBSD047738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]