SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 39947.LOC_Os02g15580.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39947.LOC_Os02g15580.1
Domain Number 1 Region: 199-391
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.4e-36
Family cAMP-binding domain 0.00000969
Further Details:      
 
Domain Number 2 Region: 15-70,132-234
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.71e-21
Family Voltage-gated potassium channels 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 39947.LOC_Os02g15580.1
Sequence length 498
Comment (Oryza sativa)
Sequence
MTAKNILMVIVICQYVPRLIRIIPLYLQITRSAGIITETAWAGAAFNLLIYMLASHVLGA
LWYLLSIQREDTCWKDACSRHDGCDSGSLFCGSNAARNNSFLQDFCPTNGTDNADPTFGI
YLPALQNVSQSTSFFEKLFYCFWWGLQNLSSLGQNLKTSTYTWENLFAVFVSTSGLVLFA
LLIGNVQTYLQSASVRIEEMRVKRRDTEQWMAHRLLPDNLKERILRHEQYRWQETRGVDE
EGLLSNLPKNLRREIKRHLCLSLLMRVPMFENMDEKLLDAMCDRLKPMLYTEGSCIIREG
DPVNEMLFIMRGNLESMTTNGGQTGFFNSNIIKGGDFCGEELLTWALDPTSASNLPSSTR
TVKTLSEVEAFALRADDLKFVATQFRRLHSKQLQHTFRFYSQQWRTWAACFIQAAWHRYC
RKKLEDTLFEKEKRLQAAIVSDGSSSLSLGAALYASRFAGNMMRILRRNATRKARLQERV
PARLLQKPAEPNFFAEDQ
Download sequence
Identical sequences I1NZ35
LOC_Os02g15580.1|13102.m01737|protein LOC_Os02g15580.1|PACid:21920275 39947.LOC_Os02g15580.1 ORGLA02G0099100.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]