SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 39947.LOC_Os03g08620.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39947.LOC_Os03g08620.1
Domain Number 1 Region: 130-227
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.12e-24
Family B3 DNA binding domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 39947.LOC_Os03g08620.1
Sequence length 237
Comment (Oryza sativa)
Sequence
MGMGMEKGMTAYEAARERTVEENKRKMEALNLRHLSAAIAVAPKTPSPMKQKRRRIIEAA
VVAPSPPRRSRRLANLPEVKYAEVAPDGAERMKRSPRKAIDSIYLATRGSISMEARLEAA
RKAEELESQLDPEFPSFVKPMLHSHVVRGFWLGLPRHFCETYLPKHDAIVTLLDEKDEQF
DTNYLAYKNGLSGGWAGFALDHGLLDGDATVFQLVKPTTFKVHIIRATVDDGNEVTK
Download sequence
Identical sequences A0A0D3FEQ2 A0A0D9Z328 A0A0E0G2D5 A0A0E0NQP1 I1P8A4 Q10QS9
XP_015633231.1.37577 39947.LOC_Os03g08620.1 LOC_Os03g08620.1|13103.m00997|protein LOC_Os03g08620.1|PACid:21913719 OGLUM03G06210.1 ONIVA02G06710.1 OBART03G06210.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]