SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39947.LOC_Os08g23410.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39947.LOC_Os08g23410.1
Domain Number 1 Region: 118-184
Classification Level Classification E-value
Superfamily Rubredoxin-like 2.86e-21
Family Rubredoxin 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 39947.LOC_Os08g23410.1
Sequence length 217
Comment (Oryza sativa)
Sequence
MALAMAPRLVHHPCCMMLSKNPRTPPPPPAMHHHHAHKPLITALTSTSSFLLRSVDVSKD
DKPLETATTTTPPTPAPAAAAPETEQAEAVASPELELELEEGPKVDPRRLEEKFAVLNTG
VYECRSCGYRYDQAAGDPSYPVPPGLPFEQLPDDWRCPTCGAAQSFFESKSVEIAGFAQN
QQFGLGGNSLTGDQKALLIYGSLLVGFLFFLSGYFLQ
Download sequence
Identical sequences A0A0D3GYX7 A0A0E0IA72 A0A0E0QHB2 A2YU61 I1QHL7 Q6Z0E5
XP_015648803.1.37577 OBART08G10480.1 LOC_Os08g23410.1|PACid:21886909 LOC_Os08g23410.1|13108.m02396|protein 39947.LOC_Os08g23410.1 ORGLA08G0091800.1 ONIVA08G11100.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]