SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 39947.LOC_Os10g25320.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39947.LOC_Os10g25320.1
Domain Number 1 Region: 4-95,175-405
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 3.65e-82
Family IF2B-like 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 39947.LOC_Os10g25320.1
Sequence length 415
Comment (Oryza sativa)
Sequence
MPDVQPLVSEFVLKLKRRKVEGSHAVARQTAELLRSVVSQHRMGSTNQAAALADAVRGVG
EQLIAANPIELAVGNIVRRVLHIIKEEDISSTAVGIEGLSVTAESDDEYDSGNDDHPTLS
AAVLAAHARNALRAPSLQTLLEDIPVSTALSRSASSAGDSDGKSAGDKSSKSRKLKHDVI
AAIGDLIDEIDTCYDQISEQAVEHIHQNEVILTLGRSRTVKEFLYAAKEKKRSFRVFVAE
GAPRYKGHVLAKELVEKGVQTTVITDSAVFAMISRVNMVIVGAHAIMANGGVIAPVGMNM
VALAAQRHAVPFVVVAGSHKLCPLYPHNPEVLLNELKSPSDLLDFGEFSSCMNFSTQDGT
PLLNVVNPTFDYVPPKLVSLFITDTGGHSPSYMYRLIAEYYSADDLVVRRKSTSS
Download sequence
Identical sequences Q338M7
LOC_Os10g25320.1|PACid:21884176 LOC_Os10g25320.1|13110.m02134|protein XP_015614907.1.37577 39947.LOC_Os10g25320.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]