SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 39947.LOC_Os12g42260.2 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39947.LOC_Os12g42260.2
Domain Number 1 Region: 268-600
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.12e-86
Family IF2B-like 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 39947.LOC_Os12g42260.2
Sequence length 607
Comment (Oryza sativa)
Sequence
MDLRRPTTRSSSGGVEPRYRQVGFVTTTAEPAAAAASSSSSPRGSDVYPGSLSPVMIPPP
RIPDHLTALSPAPVSLLPSSPPPPSSSRLDAAESDLDDDDDDDVDVSWARPPPPALLESK
EGLPDTQNEGAPAPAPVQQKQKLSKAERRAIQEAQRAAKASAKEAGLSRKSVATVSTSNA
AMSKQLKTVKTPPKKDLPQLTPPVASEKKTSEHPPDRDRKKDVPPPRMQFDNVHRVEKTK
KHSLVNQAEAQNRVELFRHLPQYVHGTQLPDLESKFFHLDLMHPSVYKVGLQFLSGVISG
GNACCVAMLLAFREAIKDYSTPSTKTLNRDLTAKISSYVSFLIECKPLSISMGNAIRFLK
NRIAKLLLTLSESEAKASLQSDIDRFINEKIIIADHVIVSHAIAKVRDDDVLLTYASSSV
VEMIFDHANELGKKFRVVVVDSRPNNEGQALLHRLVAKGISCTYTHINAISYIMHEVTRV
FLGASSILSNGAVYSSVGTAAVAMVAHAFGVPVLVCCEAYKLHERVQLDSICSNELGDPD
VISRVPEREDLCHLKNCTYNENLQLLNLKYDTMPSDYVSMIITEYGMLPPTSVPVIVREY
RREHIWI
Download sequence
Identical sequences Q2QM52
LOC_Os12g42260.1|13112.m04437|protein LOC_Os12g42260.2|13112.m04438|protein 39947.LOC_Os12g42260.2 XP_015620091.1.37577 XP_015620092.1.37577 XP_015620093.1.37577 LOC_Os12g42260.1|PACid:21937265 LOC_Os12g42260.2|PACid:21937266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]