SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 399550.Smar_0056 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  399550.Smar_0056
Domain Number 1 Region: 8-279
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 1.57e-44
Family ROO N-terminal domain-like 0.00000981
Further Details:      
 
Domain Number 2 Region: 258-401
Classification Level Classification E-value
Superfamily Flavoproteins 2.1e-26
Family Flavodoxin-related 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 399550.Smar_0056
Sequence length 406
Comment (Staphylothermus marinus F1)
Sequence
MPKTYTVEIKPGFYLLRIDDDQIKYFEGLWYIPEGITYNAYLLKTKDGYVLFDAWKHIYG
KEFINELKKIVDPKEIKYLIIHHMEPDHSGSIKDLLEINSEILVLGHPLTKGMIESFYNV
KPKFKPVKDNEVLEIGEYKLQFIYTPWLHWPETIMTYIEDLHVLLTCDAFGSYNILDKIY
DTELSPEEHKEYMFYTRKYIATVIGHYASWIEKALNKLESLGFNIEMIAPAHGIIWKNPD
IIMKYYHSWSRGTSVSGKKKIVVVYSSMYGFVDKAVKEAVKVLDEKKAFYKVYRFLDYYR
DKYSDLLADLLNSSAIILGTATYEASIFPLMRYILDLIIEKIPKNKKVLVITNYGWGGVA
GKKIRELLTNNGFEVVDVVEFRAGQIDKFRDKIVEATNKLLEILGE
Download sequence
Identical sequences A3DKK9
gi|126464968|ref|YP_001040077.1| WP_011838360.1.69113 399550.Smar_0056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]