SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 399550.Smar_0156 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  399550.Smar_0156
Domain Number 1 Region: 65-198
Classification Level Classification E-value
Superfamily Band 7/SPFH domain 2.62e-43
Family Band 7/SPFH domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 399550.Smar_0156
Sequence length 278
Comment (Staphylothermus marinus F1)
Sequence
MLPYPYIGLYFLGIEEMLPGIIFLVIILLIFLAMSIKIVREYERAVIFRLGRLLGAKGPG
LFFIIPFVDNFIKVDLRVTTVDVPEQQIITKDNVTVGVDAVVYYRVFDPVLAVTRVENYH
YAVMMMAQTTLRDIIGQVELDDLLSRREEINKRLQAILDEVTDPWGIKVTAVTLKQVRLP
ESMLRAMARQAEAERWRRAKIIEAEGEKQASIILGEAAKIYEQHPAALRLRELQTLLEIA
KEKNLIIISPSTLGAETSLLGTAIALSRKTSGSGGSGE
Download sequence
Identical sequences A3DKV9
399550.Smar_0156 gi|126465068|ref|YP_001040177.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]