SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 399550.Smar_0355 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  399550.Smar_0355
Domain Number 1 Region: 6-137
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 2.62e-27
Family CO dehydrogenase flavoprotein N-terminal domain-like 0.0031
Further Details:      
 
Domain Number 2 Region: 145-253
Classification Level Classification E-value
Superfamily CO dehydrogenase flavoprotein C-terminal domain-like 0.00000000000000445
Family CO dehydrogenase flavoprotein C-terminal domain-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 399550.Smar_0355
Sequence length 256
Comment (Staphylothermus marinus F1)
Sequence
MIRDRRIPIPKYLVDLNAIKKELSFVEKKDDGIHIGGGTTLYELSKTFLHKDKRFAGFVD
VYKKFGTLALRFEATVAGNLVSATQYNDYITLLLVYDAKLRLVSVNGERIVKLEDFLIDK
RKVDLKPNELIYEIIFPEPPINSSSSFIKFDRRELLIAGVVTGATFLALEDNKITDVKIS
FDMVREKRIPGRARKTEEFLKGKEFSKEILEKAAEEVLPTEMERVTDWWTTAEYRMDMSK
VVLKRNLLRAYERIKG
Download sequence
Identical sequences A3DLF7
399550.Smar_0355 WP_011838658.1.69113 gi|126465266|ref|YP_001040375.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]