SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 399550.Smar_0375 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  399550.Smar_0375
Domain Number 1 Region: 61-152
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.000000000000196
Family Multidrug resistance efflux transporter EmrE 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 399550.Smar_0375
Sequence length 153
Comment (Staphylothermus marinus F1)
Sequence
MLCLFFIVRWLCVVGRVEGWLVFSVLCLLFWGLWGFILKLAYSNLSWVETYFLSSLSSFI
LVLFVVSYYGLKFPPLNTYSALAFIAGFFGGAGYVFFVKALEQGKASVVIPLTALYPAIT
AVIALVVLREKISVYQGIGIILAVLASILLSLK
Download sequence
Identical sequences A3DLH7
399550.Smar_0375 WP_011838678.1.69113 gi|126465286|ref|YP_001040395.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]