SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 399550.Smar_0866 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  399550.Smar_0866
Domain Number 1 Region: 10-258
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.22e-70
Family G proteins 0.00000326
Further Details:      
 
Domain Number 2 Region: 468-628
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.32e-54
Family Translational machinery components 0.0000192
Further Details:      
 
Domain Number 3 Region: 260-383
Classification Level Classification E-value
Superfamily Translation proteins 6.48e-31
Family Elongation factors 0.001
Further Details:      
 
Domain Number 4 Region: 392-468
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 3.6e-22
Family EF-G/eEF-2 domains III and V 0.00043
Further Details:      
 
Domain Number 5 Region: 629-724
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 2.93e-21
Family EF-G/eEF-2 domains III and V 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 399550.Smar_0866
Sequence length 736
Comment (Staphylothermus marinus F1)
Sequence
MVRYKQTMEILKIMRNLEQVRNIGITAHVDHGKTTLSDSLLAAAGIISEKIAGEALALDY
LDVEQRRGITVKSANISLYHEYKGKPYVINLIDTPGHVDFSAKTTRAMRVIDGAILVVDA
VEGVMTQTEMYLRAALEERVRPVLFINKVDRLIKELRLSPQEIQQRFVQIIKEVNQLIAM
YADKEFKTKWQLDPAKGQVAFGSARDRWGFTVPMAKQKGIKFSDIVDLYKKGKEALPELQ
KLAPLHEAVLDMVVKFIPNPREAQKYRLPKIWHGDLNSEIGKAMLETDPNGPLVMLVNDV
RIDPHAGLVATGRVFSGTLRAGEEVWLVNARMKQKVLQVSLYMGPYRELADEIVAGNIAA
VLGLDKARAGETVVAVEYKDMMTPFEKLRMISEPVVTVAIEPKNPRDLPKLIDALHKLSI
EDPSLVVRINEETGEYLLSGMGPLHIEIALTFLKENYGLDVIASQPIIVYRESIRDKSRV
FEGKSPNKHNKLYISVEPLDEKTISLIHDGIITEDMDPKQRAKVLREEAGWPTDQARRIW
AIDENINVFVDLTTGVQHLREVKDTIIQGFRLAMREGPLAMEPVRGVKVILHDAIIHEDP
AHRGPGQIYPAVRNAIYAGMLTAKPTLLEPIQKLDIKAPMEYLGNITTIITKKRGKILQV
LQQGAVARIIAEIPVAETFDLAEQLRGATAGKAIWGQEFSRWAPVPDSMLLDLVRKIRER
KGLKPEPPRPEDFIGF
Download sequence
Identical sequences A3DMV6
gi|126465765|ref|YP_001040874.1| WP_011839157.1.69113 399550.Smar_0866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]