SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 399550.Smar_0966 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  399550.Smar_0966
Domain Number 1 Region: 10-94
Classification Level Classification E-value
Superfamily AlbA-like 3.66e-25
Family DNA-binding protein AlbA 0.0000777
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 399550.Smar_0966
Sequence length 98
Comment (Staphylothermus marinus F1)
Sequence
MAEAQPQAANTVLVGKKPVMNYVIAVLTLIHQGVKEIVVKARGRAISKAVDTVEIVRNRF
LPGKVDIEDINIGSQTVTNPAGRETRVSTIEIKLKVKE
Download sequence
Identical sequences A3DN55
gi|126465864|ref|YP_001040973.1| 399550.Smar_0966 WP_011839256.1.69113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]