SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 399550.Smar_1225 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  399550.Smar_1225
Domain Number 1 Region: 11-218
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.34e-59
Family Extended AAA-ATPase domain 0.000000259
Further Details:      
 
Domain Number 2 Region: 231-322
Classification Level Classification E-value
Superfamily post-AAA+ oligomerization domain-like 1.4e-22
Family DNA polymerase III clamp loader subunits, C-terminal domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 399550.Smar_1225
Sequence length 329
Comment (Staphylothermus marinus F1)
Sequence
MSSSREVIAELLWAEKYRPKTLDEIVDQEEIVSRLKQFVKERNMPHLLFAGPPGTGKTTA
AHCLAHDLFGENYRQYMLELNASDERGIDVIRSKVKEFARTRVAANIPFKIVLLDEADNM
TADAQQALRRLMEMYTATTRFILIANYPSKIIEPIQSRCAVFRFAPLKKEDVISRLKWIA
EQEKVEIDEEALEAIHDLSEGDMRRAINILQAAAALGKVTVDSVYKVVGLAHPREIRQMI
QLALAGNFNDAREKLRELMINYGLSGVDVIKQVHREIFSTDIKIPDEFKIIIADLAGEIQ
FRLVEGADDEIQLNAFLARLAFLGKKLKP
Download sequence
Identical sequences A3DNV9
WP_011839510.1.69113 399550.Smar_1225 gi|126466118|ref|YP_001041227.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]