SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 399739.Pmen_1279 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  399739.Pmen_1279
Domain Number 1 Region: 146-264
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000759
Family Tetratricopeptide repeat (TPR) 0.035
Further Details:      
 
Weak hits

Sequence:  399739.Pmen_1279
Domain Number - Region: 63-115
Classification Level Classification E-value
Superfamily FlgN-like 0.068
Family FlgN-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 399739.Pmen_1279
Sequence length 270
Comment (Pseudomonas mendocina ymp)
Sequence
MRDCRRILTLLTLALPLAAMAEVPVLESSSMQQGSSYPPAGYGTAGAYAGAGAQAPASAQ
GMLFNQLEQMQQEIAQLRGMLEEQQNEIQRLKQEGLERYQDLDQRISSGAAAGGAPAQNS
ANGAINANGTPTPPAAQQQASAEPGDPAKEKLYYDAAFDLIKAKDFDKASQAFTAFLNRY
PNSQYAGNAQYWLGEVNLAKGDLQAAGQAFAKVSQAYPSHAKVPDSLFKLADVERRLGNN
DKARGILQQVIAQYPGSSAAQLAQRDLQRL
Download sequence
Identical sequences A0A291K9I8 A4XRS8
WP_003241689.1.24137 WP_003241689.1.32543 gi|146306311|ref|YP_001186776.1| 399739.Pmen_1279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]